(data stored in ACNUC8465 zone)

EMBL: FN543502.FHUA

FN543502.FHUA        Location/Qualifiers
FT   CDS             183532..185787
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ROD_01541"
FT                   /product="ferrichrome-iron TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86934"
FT                   /db_xref="GOA:D2TI38"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI38"
FT                   /protein_id="CBG86934.1"
FT                   /translation="MARLKTAQPNSSLRKLAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAPQESAWGPAATIAARQSATATKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAE
FT                   VMRGPVSVLYGKSNPGGLLNMVSKRPTTEPLKEVQFKMGTNSLFQTGFDFSDALNDDGV
FT                   YSYRLTGLARSANAQQQGAEEQRYAIAPSFSWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVSTLPNGKRLSTDFNEGANNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRYAQNKV
FT                   AQKSVYGYGMCSDPMYSSNPDSSPCASVSQSEWGHTLTRQYVVDNEKLENFAVDTQLQS
FT                   KFATGSVDHTLLTGVDFMRMRNDIDSWFGYVGSVTPSDIYNLDRSDFDFNSRDPDTSGP
FT                   YQILNKQKQTGLYVQDQMQWDKVLVTLGGRYDWAKQDSLNRVSGTTDSREDKEFTWRGG
FT                   INYLFDNGVTPYFSYSESFEPASQTGASGNIFAPSKGKQYEAGVKYVPNDRPIVITGAV
FT                   YQLTKSNNLMSDPTPGSFFSIEGGEIRSRGVEIEAKAALSASVNVVGSYTYTDAEYTTD
FT                   TRYKGNTPAQVPEHMASLWGDYTFFDGALSGLTLGAGGRYSGSSYGDPANSFKVGSYTV
FT                   VDALVRYDLARLGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
     MARLKTAQPN SSLRKLAVVV ATAVSGMSVY AQAAVQPKEE TITVTAAPAP QESAWGPAAT        60
     IAARQSATAT KTDTPIQKVP QSISVVTAEE MALHQPKSVK EALSYTPGVA VGTRGASNTY       120
     DYLIIRGFAA DGQSQNNYLN GLKMQGNFYN DAVIDPYMLE RAEVMRGPVS VLYGKSNPGG       180
     LLNMVSKRPT TEPLKEVQFK MGTNSLFQTG FDFSDALNDD GVYSYRLTGL ARSANAQQQG       240
     AEEQRYAIAP SFSWRPDDKT NFTFLSYFQN EPETGYYGWL PKEGTVSTLP NGKRLSTDFN       300
     EGANNNTYSR NEKMVGYSFD HEFNDTFTVR QNLRYAQNKV AQKSVYGYGM CSDPMYSSNP       360
     DSSPCASVSQ SEWGHTLTRQ YVVDNEKLEN FAVDTQLQSK FATGSVDHTL LTGVDFMRMR       420
     NDIDSWFGYV GSVTPSDIYN LDRSDFDFNS RDPDTSGPYQ ILNKQKQTGL YVQDQMQWDK       480
     VLVTLGGRYD WAKQDSLNRV SGTTDSREDK EFTWRGGINY LFDNGVTPYF SYSESFEPAS       540
     QTGASGNIFA PSKGKQYEAG VKYVPNDRPI VITGAVYQLT KSNNLMSDPT PGSFFSIEGG       600
     EIRSRGVEIE AKAALSASVN VVGSYTYTDA EYTTDTRYKG NTPAQVPEHM ASLWGDYTFF       660
     DGALSGLTLG AGGRYSGSSY GDPANSFKVG SYTVVDALVR YDLARLGMAG SNVALHVNNL       720
     FDREYVASCF NTYGCFWGAE RQVVATATFR F                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page