(data stored in ACNUC8465 zone)

EMBL: FN543502.FHUB

FN543502.FHUB        Location/Qualifiers
FT   CDS             187519..189501
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ROD_01571"
FT                   /product="ferrichrome transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01571"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86937"
FT                   /db_xref="GOA:D2TI41"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI41"
FT                   /protein_id="CBG86937.1"
FT                   /translation="MSKRIALLPASLLALLFFVAAGLSWTNLSVALPRSQWQQALWSPD
FT                   IDSIGQMIFYYSLLPRLVISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGVT
FT                   VTTLWAIPGMMAAQFAALAGACIVGALVFGVAWGKRLSPVTLILAGLVVSLYCGAVNQL
FT                   LVLFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQLLGGVVLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALTLAIVLSALLVNAVGIIGFIGLFAPLLAKMLGARRLLARLMLAP
FT                   LIGALILWLSDQIILWLSRVWMEVSTGSVTALIGAPLLLWLLPRLRSMSAPDMNVSNRV
FT                   ATERRHVAGYALAGLIILLLGAWVALSLGRDVHGWSWASGALLDELMPWRWPRILAALI
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGDAFGWLLPAGSLGA
FT                   AATLLVIMIAAGRGGFSPQRMLLAGMALSTAFTMLLMMLQASGDPRMASVLTWISGSTY
FT                   NASGEQALRTGIVMVILLALTPLCRRWLTILTLGGDTARAVGMALTPSRIGLLLLAASL
FT                   TATATMTIGPLSFVGLMAPHIARMLGFRRTMPHIVMSGLVGGLLLVFADWCGRMVLFPY
FT                   QIPAGILSTFIGAPYFIYLLRKQSR"
     MSKRIALLPA SLLALLFFVA AGLSWTNLSV ALPRSQWQQA LWSPDIDSIG QMIFYYSLLP        60
     RLVISLLVGA GLGLVGVLFQ QVLRNPLAEP TTLGVATGAQ LGVTVTTLWA IPGMMAAQFA       120
     ALAGACIVGA LVFGVAWGKR LSPVTLILAG LVVSLYCGAV NQLLVLFHHD QLQSMFLWST       180
     GTLTQTDWSG VQRLWPQLLG GVVLTLLLLR PLTLMGLDDG VARNLGLALS LARLAALTLA       240
     IVLSALLVNA VGIIGFIGLF APLLAKMLGA RRLLARLMLA PLIGALILWL SDQIILWLSR       300
     VWMEVSTGSV TALIGAPLLL WLLPRLRSMS APDMNVSNRV ATERRHVAGY ALAGLIILLL       360
     GAWVALSLGR DVHGWSWASG ALLDELMPWR WPRILAALIA GVMLAVAGCI IQRLTGNPMA       420
     SPEVLGISSG AAFGVVLMLF LVPGDAFGWL LPAGSLGAAA TLLVIMIAAG RGGFSPQRML       480
     LAGMALSTAF TMLLMMLQAS GDPRMASVLT WISGSTYNAS GEQALRTGIV MVILLALTPL       540
     CRRWLTILTL GGDTARAVGM ALTPSRIGLL LLAASLTATA TMTIGPLSFV GLMAPHIARM       600
     LGFRRTMPHI VMSGLVGGLL LVFADWCGRM VLFPYQIPAG ILSTFIGAPY FIYLLRKQSR       660
//

If you have problems or comments...

PBIL Back to PBIL home page