(data stored in ACNUC8465 zone)

EMBL: FN543502.FIXB

FN543502.FIXB        Location/Qualifiers
FT   CDS             54485..55426
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ROD_00451"
FT                   /product="probable electron transfer flavoprotein subunit
FT                   of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86826"
FT                   /db_xref="GOA:D2TGL5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL5"
FT                   /protein_id="CBG86826.1"
FT                   /translation="MSKFSSVWVFSDTASRLPELMSGARALGEQVNAFVENAAEETMVI
FT                   QSGADRAWLLRGKPENRMVEDYANVMARTIRQQASEGLVLLPNTRRGKLLAAKLGYRLA
FT                   AAVSNDASEIGGQDGQAVVRHMVYGGLATGEEVIASPFAVITVNSGTFEAQQPDTSRSG
FT                   ETQVVEWQAPDITVTRTATQPRQSSSVNLDKARLVVSVGRGIGSKENIALAEALCQAIG
FT                   AELACSRPVAENEKWMAHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTICAIN
FT                   KDKNAPIFQYADYGIVGDALKILPALTAALSR"
     MSKFSSVWVF SDTASRLPEL MSGARALGEQ VNAFVENAAE ETMVIQSGAD RAWLLRGKPE        60
     NRMVEDYANV MARTIRQQAS EGLVLLPNTR RGKLLAAKLG YRLAAAVSND ASEIGGQDGQ       120
     AVVRHMVYGG LATGEEVIAS PFAVITVNSG TFEAQQPDTS RSGETQVVEW QAPDITVTRT       180
     ATQPRQSSSV NLDKARLVVS VGRGIGSKEN IALAEALCQA IGAELACSRP VAENEKWMAH       240
     ERYVGISNLM LKPELYLAVG ISGQIQHMVG ANGAQTICAI NKDKNAPIFQ YADYGIVGDA       300
     LKILPALTAA LSR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page