(data stored in ACNUC8465 zone)

EMBL: FN543502.FTSA

FN543502.FTSA        Location/Qualifiers
FT   CDS             119743..121005
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ROD_01001"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01001"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86880"
FT                   /db_xref="GOA:D2TGN1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN1"
FT                   /protein_id="CBG86880.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMINIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEADVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
     MIKATDRKLV VGLEIGTAKV AALVGEVLPD GMINIIGVGS CPSRGMDKGG VNDLESVVKC        60
     VQRAIDQAEL MADCQISSVY LALSGKHISC QNEIGMVPIS EEEVTQEDVE NVVHTAKSVR       120
     VRDEHRVLHV IPQEYAIDYQ EGIKNPVGLS GVRMQAKVHL ITCHNDMAKN IVKAVERCGL       180
     KVDQLIFAGL AASYSVLTED ERELGVCVVD IGGGTMDIAV YTGGALRHTK VIPYAGNVVT       240
     SDIAYAFGTP PSDAEAIKVR HGCALGSIVG KDESVEVPSV GGRPPRSLQR QTLAEVIEPR       300
     YTELLNLVNE EILQLQEQLR QQGVKHHLAA GIVLTGGAAQ IEGLAACAQR VFHTQVRIGA       360
     PLNITGLTDY AQEPYYSTAV GLLHYGKESH LSGEADVEKR VTASVGSWIK RLNSWLRKEF       420
//

If you have problems or comments...

PBIL Back to PBIL home page