(data stored in ACNUC8465 zone)

EMBL: FN543502.FTSQ

FN543502.FTSQ        Location/Qualifiers
FT   CDS             118916..119746
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ROD_00991"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00991"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86879"
FT                   /db_xref="GOA:D2TGN0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN0"
FT                   /protein_id="CBG86879.1"
FT                   /translation="MSQAALNTRNSDEEVSSSRRNNGTRLAGILFLLTVLCTVLVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTKNDDIRQSILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNAFSVPSDRTSKQILPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTEGKRISYVDLRYDSGAAVGWEPLPPEETNQQQNQAQAEQQ"
     MSQAALNTRN SDEEVSSSRR NNGTRLAGIL FLLTVLCTVL VSGWVVLGWM EDAQRLPLSK        60
     LVLTGERHYT KNDDIRQSIL ALGAPGTFMT QDVNIIQSQI ERLPWIKQAS VRKQWPDELK       120
     IHLVEYVPIA RWNDQHMVDA EGNAFSVPSD RTSKQILPML YGPEGSASEV LQGYREMGQV       180
     LAKDRFTLKE AAMTARRSWQ LTLNNDIKLN LGRGDTMKRL ARFVELYPVL QQQAQTEGKR       240
     ISYVDLRYDS GAAVGWEPLP PEETNQQQNQ AQAEQQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page