(data stored in ACNUC8465 zone)

EMBL: FN543502.HOFB

FN543502.HOFB        Location/Qualifiers
FT   CDS             complement(131545..132930)
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ROD_01111"
FT                   /product="protein transport protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01111"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86891"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP2"
FT                   /protein_id="CBG86891.1"
FT                   /translation="MNTTQLKALCQRYQGILLDADSEAVHVAVVDAPSHQLLDALHFAT
FT                   TKRIEIVCWTRQQMEGHLHQPQQTLPAVIPESSLSAATLLDKTLQAALTSRASDIHIEP
FT                   AEHHFRIRLRIDGVLHSLPDIAKETGVALTARLKVLSHLDIAEHRLPQDGQFTVELNGA
FT                   AVSFRIATLPCRQGEKVVLRLLHQVNQALEVTALGMHDTQLSAFNHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQSRNATEVNLCSVEDPVEIPLEGINQTQIHPRAGLTFQSVLRALL
FT                   RQDPDVIMVGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCEALVRLQQMGVARWMLSS
FT                   ALTLVVAQRLVRKLCPHCRRLTDDPVRLPQAVCAMPLPRWLAPGCEHCYHGYYGRTALF
FT                   EVLPISAGLRQQIANGATAEALEGYARQAGMLTLFESGCRAVDQGLTTFEELVRILGIP
FT                   NER"
     MNTTQLKALC QRYQGILLDA DSEAVHVAVV DAPSHQLLDA LHFATTKRIE IVCWTRQQME        60
     GHLHQPQQTL PAVIPESSLS AATLLDKTLQ AALTSRASDI HIEPAEHHFR IRLRIDGVLH       120
     SLPDIAKETG VALTARLKVL SHLDIAEHRL PQDGQFTVEL NGAAVSFRIA TLPCRQGEKV       180
     VLRLLHQVNQ ALEVTALGMH DTQLSAFNHA LQQPQGLVLV TGPTGSGKTV TLYSALQSRN       240
     ATEVNLCSVE DPVEIPLEGI NQTQIHPRAG LTFQSVLRAL LRQDPDVIMV GEIRDGETAE       300
     IAIKAAQTGH LVLSTLHTNS TCEALVRLQQ MGVARWMLSS ALTLVVAQRL VRKLCPHCRR       360
     LTDDPVRLPQ AVCAMPLPRW LAPGCEHCYH GYYGRTALFE VLPISAGLRQ QIANGATAEA       420
     LEGYARQAGM LTLFESGCRA VDQGLTTFEE LVRILGIPNE R                           461
//

If you have problems or comments...

PBIL Back to PBIL home page