(data stored in ACNUC8465 zone)

EMBL: FN543502.ILVI

FN543502.ILVI        Location/Qualifiers
FT   CDS             101305..103029
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ROD_00841"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86864"
FT                   /db_xref="GOA:D2TGD5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGD5"
FT                   /protein_id="CBG86864.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPAKKLPYTWPESVSMRSYNPTTAGHKGQIKRALQTLLSAKNPVAYVGGGAITAGC
FT                   HTQLQQLIETLNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHHSDVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVAADIPIVGDARQVLEQMLELLSQETA
FT                   AQPLDDIRDWWQQIERWRARQCLKYDAQSESIKPQAVIETLWRLTKGDAFVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPDETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIR
FT                   IARPDELEGQLSEALAQVQSGRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     MEMLSGAEMV VRSLIDQGVK QVFGYPGGAV LDIYDALHTV GGIDHVLVRH EQAAVHMADG        60
     LARATGEVGV VLVTSGPGAT NAITGIATAY MDSIPLVILS GQVATSLIGY DAFQECDMVG       120
     ISRPVVKHSF LVKQTEDIPQ VLKKAFWLAA SGRPGPVVVD LPKDILNPAK KLPYTWPESV       180
     SMRSYNPTTA GHKGQIKRAL QTLLSAKNPV AYVGGGAITA GCHTQLQQLI ETLNLPVVSS       240
     LMGLGAFPAT HRQALGMLGM HGTYEANMTM HHSDVIFAVG VRFDDRTTNN LAKYCPNATV       300
     LHIDIDPTSI SKTVAADIPI VGDARQVLEQ MLELLSQETA AQPLDDIRDW WQQIERWRAR       360
     QCLKYDAQSE SIKPQAVIET LWRLTKGDAF VTSDVGQHQM FAALYYPFDK PRRWINSGGL       420
     GTMGFGLPAA LGVKMALPDE TVVCVTGDGS IQMNIQELST ALQYELPVLV LNLNNRYLGM       480
     VKQWQDMIYS GRHSQSYMQS LPDFVRLAEA YGHVGIRIAR PDELEGQLSE ALAQVQSGRL       540
     VFVDVTVDGS EHVYPMQIRG GGMDEMWLSK TERT                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page