(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFF

FN543502.LAFF        Location/Qualifiers
FT   CDS             350633..351097
FT                   /transl_table=11
FT                   /gene="lafF"
FT                   /locus_tag="ROD_03261"
FT                   /product="lateral flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03261"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87108"
FT                   /db_xref="GOA:D2TJA0"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJA0"
FT                   /protein_id="CBG87108.1"
FT                   /translation="MKRIVMASVISSIMALVVGGGAGWGVYHFAGNGKTATAAHAEAVE
FT                   KMDESKSIFVSLQETIVTLHDNDGADHYMSAELVMVVASEKESEQIKQQEPLYQSIAVE
FT                   RLSEMKYEEIRALKISEIRKLIAEALQKELKDRKIAAPYKDILVKKVVFQ"
     MKRIVMASVI SSIMALVVGG GAGWGVYHFA GNGKTATAAH AEAVEKMDES KSIFVSLQET        60
     IVTLHDNDGA DHYMSAELVM VVASEKESEQ IKQQEPLYQS IAVERLSEMK YEEIRALKIS       120
     EIRKLIAEAL QKELKDRKIA APYKDILVKK VVFQ                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page