(data stored in ACNUC8465 zone)

EMBL: FN543502.LAFK

FN543502.LAFK        Location/Qualifiers
FT   CDS             281695..282681
FT                   /transl_table=11
FT                   /gene="lafK"
FT                   /locus_tag="ROD_02351"
FT                   /product="lateral flagellar RpoN-interacting regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02351"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87014"
FT                   /db_xref="GOA:D2TJ12"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ12"
FT                   /protein_id="CBG87014.1"
FT                   /translation="MFELIAEASSSINAFSLARRVAAFNVPVLIQGETGTGKECVAKFI
FT                   HAIAFGQNENAPYIGVNCAAIPENMLEATLFGYDKGAFTGAVATVPGKMELANNGTLLL
FT                   DEIGDMPLALQAKILRVLQEQQVERLGSNRQIKLNFRLIACTNKNLEAEVAAGRFREDL
FT                   YYRLSVVPVNIPPLRERTQDIIPLAESFIKKYSTVLVKNIRLSESTRRALLNYSWPGNV
FT                   RQLENAIQRGMILNRDGVIYPDTLGLPSSKTCDSVEAEWQTPPRLPVNGNGNLGQHGRS
FT                   AQYQYIADLMRKYHGNKNKIADLLGITPRALRYRLASMRKQGIEVYS"
     MFELIAEASS SINAFSLARR VAAFNVPVLI QGETGTGKEC VAKFIHAIAF GQNENAPYIG        60
     VNCAAIPENM LEATLFGYDK GAFTGAVATV PGKMELANNG TLLLDEIGDM PLALQAKILR       120
     VLQEQQVERL GSNRQIKLNF RLIACTNKNL EAEVAAGRFR EDLYYRLSVV PVNIPPLRER       180
     TQDIIPLAES FIKKYSTVLV KNIRLSESTR RALLNYSWPG NVRQLENAIQ RGMILNRDGV       240
     IYPDTLGLPS SKTCDSVEAE WQTPPRLPVN GNGNLGQHGR SAQYQYIADL MRKYHGNKNK       300
     IADLLGITPR ALRYRLASMR KQGIEVYS                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page