(data stored in ACNUC8465 zone)

EMBL: FN543502.LEUC

FN543502.LEUC        Location/Qualifiers
FT   CDS             complement(95128..96528)
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ROD_00801"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00801"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86859"
FT                   /db_xref="GOA:D2TGG4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG4"
FT                   /protein_id="CBG86859.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAQNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   RTMKIEVNGTAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDPDARFDTVVTLQA
FT                   EEIAPQVTWGTNPGQVISVADNIPDPASFTDPVERASAEKALAYMGLKPGVPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
     MAKTLYEKLF DAHVVYEAQN ETPLLYIDRH LVHEVTSPQA FDGLRAHGRP VRQPGKTFAT        60
     MDHNVSTQTK DINASGEMAR IQMQELIKNC KEFGVELYDL NHPYQGIVHV MGPEQGVTLP       120
     GMTIVCGDSH TATHGAFGAL AFGIGTSEVE HVLATQTLKQ GRARTMKIEV NGTAAPGITA       180
     KDIVLAIIGK TGSAGGTGHV VEFCGEAIRA LSMEGRMTLC NMAIEMGAKA GLVAPDETTF       240
     NYVKGRLHAP KGKDFDDAVA YWKTLQTDPD ARFDTVVTLQ AEEIAPQVTW GTNPGQVISV       300
     ADNIPDPASF TDPVERASAE KALAYMGLKP GVPLTEVAID KVFIGSCTNS RIEDLRAAAE       360
     VAKGRKVAPG VQALVVPGSG PVKAQAEAEG LDKIFIEAGF EWRLPGCSMC LAMNNDRLNP       420
     GERCASTSNR NFEGRQGRGG RTHLVSPAMA AAAAVTGHFA DIRSIK                      466
//

If you have problems or comments...

PBIL Back to PBIL home page