(data stored in ACNUC8465 zone)

EMBL: FN543502.LEUD

FN543502.LEUD        Location/Qualifiers
FT   CDS             complement(94512..95117)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ROD_00791"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86858"
FT                   /db_xref="GOA:D2TGG1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG1"
FT                   /protein_id="CBG86858.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDDKGEQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDEEVDELFKLVQANPGIQFEVDLEAQVIKAGEKTYSFS
FT                   IDAFRRHCMLNGLDSIGLTLQHEAAIAAYEEKQPAFMR"
     MAEKFTQHTG LVVPLDAANV DTDAIIPKQF LQKVTRTGFG AHLFNDWRFL DDKGEQPNPE        60
     FVLNFPEYQG ASILLARENF GCGSSREHAP WALTDYGFKV VIAPSFADIF YGNSFNNQLL       120
     PVKLSDEEVD ELFKLVQANP GIQFEVDLEA QVIKAGEKTY SFSIDAFRRH CMLNGLDSIG       180
     LTLQHEAAIA AYEEKQPAFM R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page