(data stored in ACNUC8465 zone)

EMBL: FN543502.LFIE

FN543502.LFIE        Location/Qualifiers
FT   CDS             282718..283074
FT                   /transl_table=11
FT                   /gene="lfiE"
FT                   /locus_tag="ROD_02361"
FT                   /product="lateral flagellar basal body component protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87015"
FT                   /db_xref="GOA:D2TJ13"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ13"
FT                   /protein_id="CBG87015.1"
FT                   /translation="MSITNIQPAGTMQAQMLREMQQMQAVARTPVLSSMQISAAGEASS
FT                   TVSFHRIMQGALSHVDQFQQAAEEKQTAIDMGKSDDLAGAMIASQQASLSFSALVQVRN
FT                   KIATGFNDLMSMSI"
     MSITNIQPAG TMQAQMLREM QQMQAVARTP VLSSMQISAA GEASSTVSFH RIMQGALSHV        60
     DQFQQAAEEK QTAIDMGKSD DLAGAMIASQ QASLSFSALV QVRNKIATGF NDLMSMSI         118
//

If you have problems or comments...

PBIL Back to PBIL home page