(data stored in ACNUC8465 zone)

EMBL: FN543502.LFIR

FN543502.LFIR        Location/Qualifiers
FT   CDS             complement(278032..278814)
FT                   /transl_table=11
FT                   /gene="lfiR"
FT                   /locus_tag="ROD_02291"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87009"
FT                   /db_xref="GOA:D2TJ07"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ07"
FT                   /protein_id="CBG87009.1"
FT                   /translation="MRESDITQLANLVLGLWFPFVRIMAFIRYVPVFDNAALTIRVRII
FT                   LSLALAIVITPMIPHPVPDSLLSMNSLILTAEQILWGMLFGLMFQFLFLALQLAGQILS
FT                   FNMGMSMAVMNDPGSGASTTVLAELINVYAVILFFAMDGHLLLVSVLYKGFTYWPIGNA
FT                   LHPQSLRTLALAFSWVLGSAMLLALPTTFIMLIVQGCFGLLNRVAPPLNLYSLGFPINM
FT                   LAGLICFATLLYNLPDHYLHLANFILKQLDALKGHYGG"
     MRESDITQLA NLVLGLWFPF VRIMAFIRYV PVFDNAALTI RVRIILSLAL AIVITPMIPH        60
     PVPDSLLSMN SLILTAEQIL WGMLFGLMFQ FLFLALQLAG QILSFNMGMS MAVMNDPGSG       120
     ASTTVLAELI NVYAVILFFA MDGHLLLVSV LYKGFTYWPI GNALHPQSLR TLALAFSWVL       180
     GSAMLLALPT TFIMLIVQGC FGLLNRVAPP LNLYSLGFPI NMLAGLICFA TLLYNLPDHY       240
     LHLANFILKQ LDALKGHYGG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page