(data stored in ACNUC8465 zone)

EMBL: FN543502.MURG

FN543502.MURG        Location/Qualifiers
FT   CDS             115401..116468
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ROD_00961"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(penta
FT                   peptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00961"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86876"
FT                   /db_xref="GOA:D2TGM7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGM7"
FT                   /protein_id="CBG86876.1"
FT                   /translation="MSGQAKRLMVMAGGTGGHVFPGLAVAHHLMAQGWEVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKAFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATRVMQAFPGAFPKAEVVGNPVR
FT                   TDVLALPLPQARLSGREGPIRVLVVGGSQGARVLNQTLPQAAAKLGSAVTIWHQSGKGA
FT                   QQAVEQAYADAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEQAGAARILEQPQFTVDAVVSTLSGWNREVLLEMAQRARAAAIPD
FT                   ATERVANEVSLVARA"
     MSGQAKRLMV MAGGTGGHVF PGLAVAHHLM AQGWEVRWLG TADRMEADLV PKHGIEIDFI        60
     RISGLRGKGV KALLAAPLRI FNAWRQARAI MKAFKPDVVL GMGGYVSGPG GLAAWSLGIP       120
     VVLHEQNGIA GLTNKWLAKI ATRVMQAFPG AFPKAEVVGN PVRTDVLALP LPQARLSGRE       180
     GPIRVLVVGG SQGARVLNQT LPQAAAKLGS AVTIWHQSGK GAQQAVEQAY ADAGQPQHKV       240
     TEFIDDMAAA YAWADVVVCR SGALTVSEIA AAGLPALFVP FQHKDRQQYW NALPLEQAGA       300
     ARILEQPQFT VDAVVSTLSG WNREVLLEMA QRARAAAIPD ATERVANEVS LVARA            355
//

If you have problems or comments...

PBIL Back to PBIL home page