(data stored in ACNUC8465 zone)

EMBL: FN543502.PE135

FN543502.PE135       Location/Qualifiers
FT   CDS             complement(159812..160120)
FT                   /transl_table=11
FT                   /locus_tag="ROD_01331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86913"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:D2THD8"
FT                   /protein_id="CBG86913.1"
FT                   /translation="MAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRA
FT                   LVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
     MAVCANSYAL SESEAEDMAD LTAVFVFLKN DCGYQNLPNG QIRRALVFFA QQNQWDLSNY        60
     DTFDMKSLGE DSYRDLSGIG IPVAKKCKAL ARDSLSLLAY VK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page