(data stored in ACNUC8465 zone)

EMBL: FN543502.PE142

FN543502.PE142       Location/Qualifiers
FT   CDS             168244..169014
FT                   /transl_table=11
FT                   /locus_tag="ROD_01401"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01401"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86920"
FT                   /db_xref="GOA:D2THE5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2THE5"
FT                   /protein_id="CBG86920.1"
FT                   /translation="MMQLYWVALKSIWAKEINRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNAYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGVLVTAVSLFFVPFQVHSWLFVAMTLVLTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLLIFIIAFYLLCWTLIQRGRGLRS"
     MMQLYWVALK SIWAKEINRF MRIWVQTLVP PVITMTLYFI IFGNLIGSRI GEMHGFSYMQ        60
     FIVPGLIMMA VITNAYANVA SSFFSAKFQR NIEELLVAPV PTHVIIAGFV GGGVARGLCV       120
     GVLVTAVSLF FVPFQVHSWL FVAMTLVLTA ILFSLAGLLN AVFAKTFDDI SLIPTFVLTP       180
     LTYLGGVFYS LTLLPPFWQG LSHLNPIVYM ISGFRYGFLG IHDVPLVTTF GVLLIFIIAF       240
     YLLCWTLIQR GRGLRS                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page