(data stored in ACNUC8465 zone)

EMBL: FN543502.PE200

FN543502.PE200       Location/Qualifiers
FT   CDS             234298..234843
FT                   /transl_table=11
FT                   /locus_tag="ROD_01981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01981"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86978"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI81"
FT                   /protein_id="CBG86978.1"
FT                   /translation="MALKATIYKAVVNVADLDRNQFLDAPLTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAQEVAL
FT                   FTYNSRAAQIWWQQQQSKCAQFTNLTVWYLDDEQLAQLSEFAGRTMALQATIQDGAIWL
FT                   SDAQNNLEIHLTAWQQPG"
     MALKATIYKA VVNVADLDRN QFLDAPLTLA RHPSETQERM MLRLLAWIKY ADERLQFTRG        60
     LSAEDEPEAW LRNDHLGIDL WIELGLPDER RIKKACTQAQ EVALFTYNSR AAQIWWQQQQ       120
     SKCAQFTNLT VWYLDDEQLA QLSEFAGRTM ALQATIQDGA IWLSDAQNNL EIHLTAWQQP       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page