(data stored in ACNUC8465 zone)

EMBL: FN543502.PE203

FN543502.PE203       Location/Qualifiers
FT   CDS             236570..237907
FT                   /transl_table=11
FT                   /locus_tag="ROD_02011"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02011"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86981"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI84"
FT                   /protein_id="CBG86981.1"
FT                   /translation="MNKKLIALAILFAMGSAHACENTEDCKAAVDDVYEAINTKMQPKQ
FT                   ENESAAVWGEKYANWLGRVNEVAERRLGTTFDNLGDIARWEIANSKTGSSANADSGENG
FT                   NTGATDTNTKNPTGDFIEPELETAYVTAGQAQAGDRAAIAQAQDYADSVATEVENKTKD
FT                   YAAQVATETAATAANNAIGLAAQVATETAATAENNAKGYAANVATAAESKAKQYATSVA
FT                   TDAASTAQTNAEGYAAQVATETAATAENNAKGYASQIATKAADSAKNAAETHADKAATE
FT                   AKSAAVKEAKDDARAQVTAAEKRSNAHADATAKKAEVNANDYTDQQMATAEEYATTLAH
FT                   STIRYANQSLQESKSYTDRVARGLQKQINHNGKAIKRLGASAQATANLHYNANHNGYAI
FT                   AVGEYNSETALAGGLQFNTGKSTAVTVQGSYDAESFGGSVGLHGDW"
     MNKKLIALAI LFAMGSAHAC ENTEDCKAAV DDVYEAINTK MQPKQENESA AVWGEKYANW        60
     LGRVNEVAER RLGTTFDNLG DIARWEIANS KTGSSANADS GENGNTGATD TNTKNPTGDF       120
     IEPELETAYV TAGQAQAGDR AAIAQAQDYA DSVATEVENK TKDYAAQVAT ETAATAANNA       180
     IGLAAQVATE TAATAENNAK GYAANVATAA ESKAKQYATS VATDAASTAQ TNAEGYAAQV       240
     ATETAATAEN NAKGYASQIA TKAADSAKNA AETHADKAAT EAKSAAVKEA KDDARAQVTA       300
     AEKRSNAHAD ATAKKAEVNA NDYTDQQMAT AEEYATTLAH STIRYANQSL QESKSYTDRV       360
     ARGLQKQINH NGKAIKRLGA SAQATANLHY NANHNGYAIA VGEYNSETAL AGGLQFNTGK       420
     STAVTVQGSY DAESFGGSVG LHGDW                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page