(data stored in ACNUC8465 zone)

EMBL: FN543502.PE216

FN543502.PE216       Location/Qualifiers
FT   CDS             260045..260845
FT                   /transl_table=11
FT                   /locus_tag="ROD_02141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02141"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86994"
FT                   /db_xref="GOA:D2TI96"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI96"
FT                   /protein_id="CBG86994.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFSGIGQALPAGAPLSSEDRIR
FT                   ILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATTNYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDP"
     MRKNTYAMRY VAGQPAERIL PPGSFSGIGQ ALPAGAPLSS EDRIRILVWN IFKQQRAEWL        60
     SVLKNYGKDA HLVLLQEAQT TPELVQFATT NYLAADQVPA FVLPQHPSGV MTLSAAHPVY       120
     CCPLREREPI LRLAKSALVT VYPLPDTRLL MVVNIHAVNF SLGVDVYSKQ LLPIGDQIAH       180
     HSGPVIMAGD FNAWSRRRMN ALYRFAREMS LRQVRFTDDQ RRRAFGRPLD FVFYRGLNVS       240
     EASVLVTRAS DHNPLLVEFS PGKPDP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page