(data stored in ACNUC8465 zone)

EMBL: FN543502.PE24

FN543502.PE24        Location/Qualifiers
FT   CDS             27111..27326
FT                   /transl_table=11
FT                   /locus_tag="ROD_00213"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86802"
FT                   /db_xref="GOA:D2TGJ8"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGJ8"
FT                   /protein_id="CBG86802.1"
FT                   /translation="MRRSLRSDGAGFYQLAGREYSFSARKIELRCLLTACICLIAMKSI
FT                   LFLFRGINRRLTLTAVQGILWRFSLF"
     MRRSLRSDGA GFYQLAGREY SFSARKIELR CLLTACICLI AMKSILFLFR GINRRLTLTA        60
     VQGILWRFSL F                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page