(data stored in ACNUC8465 zone)

EMBL: FN543502.PE240

FN543502.PE240       Location/Qualifiers
FT   CDS             complement(285654..286226)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02391"
FT                   /product="putative phage tail fibre protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87018"
FT                   /db_xref="InterPro:IPR025484"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ15"
FT                   /protein_id="CBG87018.1"
FT                   /translation="MMQIKEITSPRYTESGAIDCDVLFEEMEAPVPYTATPDDTAKTGQ
FT                   QIWQELQSGKWGEITPFTASPELIAAAKDAKKREIEAWRTEQEAQPFTFEWNGHTWNAG
FT                   PDSMTRLYPVVMAAKSDTARTALAWGDADNQQVKLSMPELEELAAAMAQAQVERNDEIY
FT                   QRQREMKEELNNLDDLRSIRAMTISSS"
     MMQIKEITSP RYTESGAIDC DVLFEEMEAP VPYTATPDDT AKTGQQIWQE LQSGKWGEIT        60
     PFTASPELIA AAKDAKKREI EAWRTEQEAQ PFTFEWNGHT WNAGPDSMTR LYPVVMAAKS       120
     DTARTALAWG DADNQQVKLS MPELEELAAA MAQAQVERND EIYQRQREMK EELNNLDDLR       180
     SIRAMTISSS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page