(data stored in ACNUC8465 zone)

EMBL: FN543502.PE248

FN543502.PE248       Location/Qualifiers
FT   CDS             complement(292152..293363)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02471"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02471"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87026"
FT                   /db_xref="InterPro:IPR026276"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ23"
FT                   /protein_id="CBG87026.1"
FT                   /translation="MPTQNNDDKISLVIAGRSHSDWSSYRIDSDFLKAADGWQLQLGLP
FT                   EKVFPADIVRGAPVRLQVGDETVLSGRVDSVRRSVSRQSCTLTLSGRDDAAILVDCAAP
FT                   VFSANQLTLDEVIDRIVRPLGIQRIRIQASGVSRNDKVVIEPGMRAWDALAKAAAGRGL
FT                   WPWFEPDGTLVVGGPDYTTTPVDTLIMKLDGTGNNVMELDDTRSINGCFSELTVLAQSH
FT                   ARRADSKKQVAVVPLDIWNEDGSVRTLSGQDSGNTGSGQTGIHNMKAVATDPTVDYYRP
FT                   QIITQGDTSNMEQVNWRAKKMMSDARLSGLDIVALVAGHRTADGVLWQPGQRVRIVSEP
FT                   HGIDAIFFLMGREFSGGRNGQTTRLRFKEDGVWIPDAFPREKKRHHRRGKKKKEVAIVK
FT                   VWEK"
     MPTQNNDDKI SLVIAGRSHS DWSSYRIDSD FLKAADGWQL QLGLPEKVFP ADIVRGAPVR        60
     LQVGDETVLS GRVDSVRRSV SRQSCTLTLS GRDDAAILVD CAAPVFSANQ LTLDEVIDRI       120
     VRPLGIQRIR IQASGVSRND KVVIEPGMRA WDALAKAAAG RGLWPWFEPD GTLVVGGPDY       180
     TTTPVDTLIM KLDGTGNNVM ELDDTRSING CFSELTVLAQ SHARRADSKK QVAVVPLDIW       240
     NEDGSVRTLS GQDSGNTGSG QTGIHNMKAV ATDPTVDYYR PQIITQGDTS NMEQVNWRAK       300
     KMMSDARLSG LDIVALVAGH RTADGVLWQP GQRVRIVSEP HGIDAIFFLM GREFSGGRNG       360
     QTTRLRFKED GVWIPDAFPR EKKRHHRRGK KKKEVAIVKV WEK                         403
//

If you have problems or comments...

PBIL Back to PBIL home page