(data stored in ACNUC8465 zone)

EMBL: FN543502.PE250

FN543502.PE250       Location/Qualifiers
FT   CDS             complement(294696..296978)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02491"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02491"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87028"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ25"
FT                   /protein_id="CBG87028.1"
FT                   /translation="MAGNFKVGMTLTAKDEASQVLEKGQKQVIKATEGVTKATRKAGAE
FT                   QKRTEQESINSTKKAAKEIQRAARARETLGIRAEREIRREIYLTVASYNRLARAGFESA
FT                   QEQERAMQATREKARALKRELDGVTQAQMKMAKTPVIPEQGRFARAAAFGGNAVTTGAG
FT                   IAAGAAIMAQPVKKQMSYERQLTMMANTAFSDGGLEGRQSGREKLKNSIRAAVTYGGGT
FT                   KEDAADAMNEMLASGAFSWDTANNLLPQIMKFATASGASPRDLVTMAAKAKQTFGLTDN
FT                   DLPAMFNMAIAAGKAGNFELRDMAEHLGPQMALAGNAGMKGLDGFQKLLAFNEVAGIAA
FT                   GSSSEAGNNVVNLLAKLFSSESATRAKSITIDGKGIDLPGTLTRAMENGIDPIEAFSRL
FT                   ADKVAANNKQYQELQKRLAATKDKGQQDKILESMAKILEGFGVGELVGDMQALKAILAY
FT                   RNNPEYRKQVEAEISQQRTLPEGQRAGDVDFKFISDTNDFKTGQAKNTLEFSQMDSMKK
FT                   LADASGAVADAISWAGEEFPGLTTAVVGATTAIEAMTAAALTWAGIKILTGSKPGGKAG
FT                   EVVGDVIENTVKKGKGFKFPGIAGGLLSFGSTVTALATATSPEEDAAVEGSEERWKNIR
FT                   AKYPQWLIDAAREKYQPWWQFGEGYSTENEKWIQQYLDELKKTGVIAGDSLPTPEQVRQ
FT                   QAGMAAPEPASKPPGRINQPEYLTHWGPPASPINFTTQLVLDGQVVAEAVNKYNLQDGN
FT                   RGTGGTY"
     MAGNFKVGMT LTAKDEASQV LEKGQKQVIK ATEGVTKATR KAGAEQKRTE QESINSTKKA        60
     AKEIQRAARA RETLGIRAER EIRREIYLTV ASYNRLARAG FESAQEQERA MQATREKARA       120
     LKRELDGVTQ AQMKMAKTPV IPEQGRFARA AAFGGNAVTT GAGIAAGAAI MAQPVKKQMS       180
     YERQLTMMAN TAFSDGGLEG RQSGREKLKN SIRAAVTYGG GTKEDAADAM NEMLASGAFS       240
     WDTANNLLPQ IMKFATASGA SPRDLVTMAA KAKQTFGLTD NDLPAMFNMA IAAGKAGNFE       300
     LRDMAEHLGP QMALAGNAGM KGLDGFQKLL AFNEVAGIAA GSSSEAGNNV VNLLAKLFSS       360
     ESATRAKSIT IDGKGIDLPG TLTRAMENGI DPIEAFSRLA DKVAANNKQY QELQKRLAAT       420
     KDKGQQDKIL ESMAKILEGF GVGELVGDMQ ALKAILAYRN NPEYRKQVEA EISQQRTLPE       480
     GQRAGDVDFK FISDTNDFKT GQAKNTLEFS QMDSMKKLAD ASGAVADAIS WAGEEFPGLT       540
     TAVVGATTAI EAMTAAALTW AGIKILTGSK PGGKAGEVVG DVIENTVKKG KGFKFPGIAG       600
     GLLSFGSTVT ALATATSPEE DAAVEGSEER WKNIRAKYPQ WLIDAAREKY QPWWQFGEGY       660
     STENEKWIQQ YLDELKKTGV IAGDSLPTPE QVRQQAGMAA PEPASKPPGR INQPEYLTHW       720
     GPPASPINFT TQLVLDGQVV AEAVNKYNLQ DGNRGTGGTY                             760
//

If you have problems or comments...

PBIL Back to PBIL home page