(data stored in ACNUC8465 zone)

EMBL: FN543502.PE254

FN543502.PE254       Location/Qualifiers
FT   CDS             complement(299322..299555)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02522"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02522"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87032"
FT                   /db_xref="InterPro:IPR024400"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ29"
FT                   /protein_id="CBG87032.1"
FT                   /translation="MKVKAAPGMKFPMEDNARKYITTEAVTVENTAYYRRAVQDGDLIL
FT                   VKAEPETTVTAEQDAVQVKAKAKREKQVDSDE"
     MKVKAAPGMK FPMEDNARKY ITTEAVTVEN TAYYRRAVQD GDLILVKAEP ETTVTAEQDA        60
     VQVKAKAKRE KQVDSDE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page