(data stored in ACNUC8465 zone)

EMBL: FN543502.PE255

FN543502.PE255       Location/Qualifiers
FT   CDS             complement(299545..300198)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02531"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02531"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87033"
FT                   /db_xref="InterPro:IPR014972"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ30"
FT                   /protein_id="CBG87033.1"
FT                   /translation="MITDIERALVERLRCGLGHMVQDVRTYAGELDEDPGRIVRSLPAA
FT                   WVTFGGIVKTERYSTSRRKYIATGRFVVVVGDYNTRSEQSARQGGTVRDEVGTNQLVES
FT                   VRRLLTGQDLGLEIDYFEPGRVRTLFNTGVAERAMSVFACEFDTRWVEHALENGKWPER
FT                   GAEADRLFNRYHGRLSDPDPELLNLGIRYQMQDSDAEISGLTELREQQHEQNEG"
     MITDIERALV ERLRCGLGHM VQDVRTYAGE LDEDPGRIVR SLPAAWVTFG GIVKTERYST        60
     SRRKYIATGR FVVVVGDYNT RSEQSARQGG TVRDEVGTNQ LVESVRRLLT GQDLGLEIDY       120
     FEPGRVRTLF NTGVAERAMS VFACEFDTRW VEHALENGKW PERGAEADRL FNRYHGRLSD       180
     PDPELLNLGI RYQMQDSDAE ISGLTELREQ QHEQNEG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page