(data stored in ACNUC8465 zone)

EMBL: FN543502.PE258

FN543502.PE258       Location/Qualifiers
FT   CDS             complement(300966..301874)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02561"
FT                   /product="putative phage major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02561"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87036"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ33"
FT                   /protein_id="CBG87036.1"
FT                   /translation="MIVNAKNLNQIFINLKTTYQKAFDQTPTDWQKVAMEVPSGSKEND
FT                   YSWLSRFPKMREWVGDKNVKSLEAFNYTIRNKDWEATVEVDRNDIEDDQIMGYALQARD
FT                   AGQSAAELPADIVASLINNGFTSPCYDGQMFFDTDHLVAGKSVSNKGTKKLKVGSLAEA
FT                   KASYGAARTAMRSLKDDEGASLRIRPNLLVVPPALEDDANYLMTAEKFPDGTPNPYRNT
FT                   AEVLVMPELTSDSAWFLFDTSRSVKPLIFQQRKKPVFVEQTDYNSDNVFMRKKFRFGAE
FT                   ARCNGGYGFWQMAFGSDGTTE"
     MIVNAKNLNQ IFINLKTTYQ KAFDQTPTDW QKVAMEVPSG SKENDYSWLS RFPKMREWVG        60
     DKNVKSLEAF NYTIRNKDWE ATVEVDRNDI EDDQIMGYAL QARDAGQSAA ELPADIVASL       120
     INNGFTSPCY DGQMFFDTDH LVAGKSVSNK GTKKLKVGSL AEAKASYGAA RTAMRSLKDD       180
     EGASLRIRPN LLVVPPALED DANYLMTAEK FPDGTPNPYR NTAEVLVMPE LTSDSAWFLF       240
     DTSRSVKPLI FQQRKKPVFV EQTDYNSDNV FMRKKFRFGA EARCNGGYGF WQMAFGSDGT       300
     TE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page