(data stored in ACNUC8465 zone)

EMBL: FN543502.PE264

FN543502.PE264       Location/Qualifiers
FT   CDS             complement(306902..308542)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02621"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87042"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ39"
FT                   /protein_id="CBG87042.1"
FT                   /translation="MAKRKLSIKEFQRSLQEYIANLRQTIEAECLGFDVNPQATQARRA
FT                   AVCDPVTGYDYFVENYFPHYVRNPAKSELHKYLFSRLPQVVASPAPENDAIAAPRGEAK
FT                   STLVTQLFTLWTIIRAIKHYPVIIMDSIDQAYPMLEAIKAELEFNPRLKNDFPEVCGQG
FT                   RVWRMGTIVTANNIKVTVAGSGKKLRGLRHGPYRPDLIILDDIENDEMVRNPEQRDKLH
FT                   DWLTKTVMPLGEAGGKTDIIYIGTILHYDSVLSRTLNNPMWKTARFKAVIQWPANMKLW
FT                   DEWEELIRNKQPEAAEALYRQNEAEMLAGSVVSWAARPLLALMKIRVRDGHDTFDSEYQ
FT                   NDPVSGEDALFAGCIKFWVNRLDEWVFYGAVDPSLGKKNKNRDPSAILVGGFNRFTGIL
FT                   DVVEADIRRRLPNKLIEDVIKYQREYHCLCWSFESVQFQEFLRTVLVERSAALGVPVPA
FT                   LPVIPLEDKALRIESLQPHMANGLIRISHTHQTLIDQLRHYPKADHDDGPDCLHMLWTL
FT                   AVSRSAKFQIHTPRSTGRDRGGRFGSGGW"
     MAKRKLSIKE FQRSLQEYIA NLRQTIEAEC LGFDVNPQAT QARRAAVCDP VTGYDYFVEN        60
     YFPHYVRNPA KSELHKYLFS RLPQVVASPA PENDAIAAPR GEAKSTLVTQ LFTLWTIIRA       120
     IKHYPVIIMD SIDQAYPMLE AIKAELEFNP RLKNDFPEVC GQGRVWRMGT IVTANNIKVT       180
     VAGSGKKLRG LRHGPYRPDL IILDDIENDE MVRNPEQRDK LHDWLTKTVM PLGEAGGKTD       240
     IIYIGTILHY DSVLSRTLNN PMWKTARFKA VIQWPANMKL WDEWEELIRN KQPEAAEALY       300
     RQNEAEMLAG SVVSWAARPL LALMKIRVRD GHDTFDSEYQ NDPVSGEDAL FAGCIKFWVN       360
     RLDEWVFYGA VDPSLGKKNK NRDPSAILVG GFNRFTGILD VVEADIRRRL PNKLIEDVIK       420
     YQREYHCLCW SFESVQFQEF LRTVLVERSA ALGVPVPALP VIPLEDKALR IESLQPHMAN       480
     GLIRISHTHQ TLIDQLRHYP KADHDDGPDC LHMLWTLAVS RSAKFQIHTP RSTGRDRGGR       540
     FGSGGW                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page