(data stored in ACNUC8465 zone)

EMBL: FN543502.PE267

FN543502.PE267       Location/Qualifiers
FT   CDS             complement(309831..310151)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02651"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02651"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87045"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ42"
FT                   /protein_id="CBG87045.1"
FT                   /translation="MKQKENTAIALVEAAVPGRPFKFGLTQVVALHVSGECGEIKARTQ
FT                   YADGENRYLVYYQDARKAAQLKWFGESMLEMIEDVRHPGMPVFAVTELPDDATVSDTRK
FT                   GV"
     MKQKENTAIA LVEAAVPGRP FKFGLTQVVA LHVSGECGEI KARTQYADGE NRYLVYYQDA        60
     RKAAQLKWFG ESMLEMIEDV RHPGMPVFAV TELPDDATVS DTRKGV                      106
//

If you have problems or comments...

PBIL Back to PBIL home page