(data stored in ACNUC8465 zone)

EMBL: FN543502.PE277

FN543502.PE277       Location/Qualifiers
FT   CDS             complement(314794..315057)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02733"
FT                   /product="putative prophage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02733"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87055"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ51"
FT                   /protein_id="CBG87055.1"
FT                   /translation="MNNGCLVAVVFIVFGACFFLVDNTTHTTTNEQESPHCVVRKNFSQ
FT                   RTITHCDDGSATVTDGDKFIYCSTGKNGSPSCHEVTLGDGDK"
     MNNGCLVAVV FIVFGACFFL VDNTTHTTTN EQESPHCVVR KNFSQRTITH CDDGSATVTD        60
     GDKFIYCSTG KNGSPSCHEV TLGDGDK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page