(data stored in ACNUC8465 zone)

EMBL: FN543502.PE282

FN543502.PE282       Location/Qualifiers
FT   CDS             complement(315959..316147)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02771"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02771"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87060"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ56"
FT                   /protein_id="CBG87060.1"
FT                   /translation="MNQQTRISDKSLTRLIADADKVLERNTPVADEEWWQDFRAAMLEL
FT                   QERRRADSTESVVNTGE"
     MNQQTRISDK SLTRLIADAD KVLERNTPVA DEEWWQDFRA AMLELQERRR ADSTESVVNT        60
     GE                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page