(data stored in ACNUC8465 zone)

EMBL: FN543502.PE292

FN543502.PE292       Location/Qualifiers
FT   CDS             complement(319968..320612)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02861"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02861"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87070"
FT                   /db_xref="InterPro:IPR021505"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ65"
FT                   /protein_id="CBG87070.1"
FT                   /translation="MTTENKVKQYTKTQAPEGYWVDARGVMTPESLIKDIDRDREQLVG
FT                   ELVEMVIAASASLRELKLRAFGDIQAFIDLSAEKYGAVKGGKKGNITLYSFDGRYKIQR
FT                   AMQDRIAFDERIQTAKSLIDDCLADWTEGARPEIKAIISEAFSTDKEGNINTGRVLALR
FT                   RLEIEDERWNNAMTLIGEAVQVIGSKSYIRVYERVGDSDEYRAIPLDIAGV"
     MTTENKVKQY TKTQAPEGYW VDARGVMTPE SLIKDIDRDR EQLVGELVEM VIAASASLRE        60
     LKLRAFGDIQ AFIDLSAEKY GAVKGGKKGN ITLYSFDGRY KIQRAMQDRI AFDERIQTAK       120
     SLIDDCLADW TEGARPEIKA IISEAFSTDK EGNINTGRVL ALRRLEIEDE RWNNAMTLIG       180
     EAVQVIGSKS YIRVYERVGD SDEYRAIPLD IAGV                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page