(data stored in ACNUC8465 zone)

EMBL: FN543502.PE295

FN543502.PE295       Location/Qualifiers
FT   CDS             complement(321054..321320)
FT                   /transl_table=11
FT                   /locus_tag="ROD_02891"
FT                   /product="hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02891"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87073"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ68"
FT                   /protein_id="CBG87073.1"
FT                   /translation="MQRRNVNSLMENKTMDKQTINAVRSRARVAIHTTGGRVTGQHHRL
FT                   PVVYACPPVGGPVWPVTEIIQTFSGLRRVVKTSCIDGCTVVWQ"
     MQRRNVNSLM ENKTMDKQTI NAVRSRARVA IHTTGGRVTG QHHRLPVVYA CPPVGGPVWP        60
     VTEIIQTFSG LRRVVKTSCI DGCTVVWQ                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page