(data stored in ACNUC8465 zone)

EMBL: FN543502.PE32

FN543502.PE32        Location/Qualifiers
FT   CDS             complement(35427..36230)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00291"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86810"
FT                   /db_xref="GOA:D2TGL0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL0"
FT                   /protein_id="CBG86810.1"
FT                   /translation="MIFEATLIGILCYLGALSSPWLFGLTGGWYLITRPLISGMLVGLI
FT                   LGDMQTGIVIGVAVQAVYIAMVTPGGSMPADLNFVAYPAIALGILSGKGPEVAVALAAT
FT                   IGIAGTILFNAMMVLNSFWNHRADVALERGDERGLYLNSAIWPQVSNFILRFVPTFIAV
FT                   YFGAQYISGFMDSLPGIVLSTMNVLGGILPAVGIAILLKQIIKNYSMLIYFLVGFVCIV
FT                   FLKLNMVALVIVGSLLALIHYNYKPEAPQAVNAASAAKDDDEDEF"
     MIFEATLIGI LCYLGALSSP WLFGLTGGWY LITRPLISGM LVGLILGDMQ TGIVIGVAVQ        60
     AVYIAMVTPG GSMPADLNFV AYPAIALGIL SGKGPEVAVA LAATIGIAGT ILFNAMMVLN       120
     SFWNHRADVA LERGDERGLY LNSAIWPQVS NFILRFVPTF IAVYFGAQYI SGFMDSLPGI       180
     VLSTMNVLGG ILPAVGIAIL LKQIIKNYSM LIYFLVGFVC IVFLKLNMVA LVIVGSLLAL       240
     IHYNYKPEAP QAVNAASAAK DDDEDEF                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page