(data stored in ACNUC8465 zone)

EMBL: FN543502.PE334

FN543502.PE334       Location/Qualifiers
FT   CDS             353776..354417
FT                   /transl_table=11
FT                   /locus_tag="ROD_03301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03301"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87112"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJY4"
FT                   /protein_id="CBG87112.1"
FT                   /translation="MIDASEIIPLDIHDGQIADAVCQGAHYDAHSGVWYVEPHELTDAL
FT                   RNFAYDAVDFNIVAPYYLVITSKVQCSSCRQPTDIIAVMFTRYLKKSQDGRRWLSVTGN
FT                   SFLFHINQLPEAIRKNIKAKNYYPDKSKTSGLRYWMNHCEVCGERLSDYALFCVEEDLF
FT                   KRMPVERLLKADIRKVKRMFVCQAGNPADDSRPCPVNFTCEARFRLRGPR"
     MIDASEIIPL DIHDGQIADA VCQGAHYDAH SGVWYVEPHE LTDALRNFAY DAVDFNIVAP        60
     YYLVITSKVQ CSSCRQPTDI IAVMFTRYLK KSQDGRRWLS VTGNSFLFHI NQLPEAIRKN       120
     IKAKNYYPDK SKTSGLRYWM NHCEVCGERL SDYALFCVEE DLFKRMPVER LLKADIRKVK       180
     RMFVCQAGNP ADDSRPCPVN FTCEARFRLR GPR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page