(data stored in ACNUC8465 zone)

EMBL: FN543502.PE34

FN543502.PE34        Location/Qualifiers
FT   CDS             complement(36747..37175)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00311"
FT                   /product="putative PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86812"
FT                   /db_xref="GOA:D2TGL2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGL2"
FT                   /protein_id="CBG86812.1"
FT                   /translation="MINIIVATHGPLAEALLASARMVYGDLPHVYTATLSEQSGIEGFK
FT                   ESFAKTLAEAGQNADGVLVLCDMQSGTPWNVACQYAFSPDTQPPVAVVAGVNFPMLLQS
FT                   EEINPLTDVHAAADELLALTVPTLVKAAPVVTTQSEDF"
     MINIIVATHG PLAEALLASA RMVYGDLPHV YTATLSEQSG IEGFKESFAK TLAEAGQNAD        60
     GVLVLCDMQS GTPWNVACQY AFSPDTQPPV AVVAGVNFPM LLQSEEINPL TDVHAAADEL       120
     LALTVPTLVK AAPVVTTQSE DF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page