(data stored in ACNUC8465 zone)

EMBL: FN543502.PE354

FN543502.PE354       Location/Qualifiers
FT   CDS             complement(379868..381265)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03501"
FT                   /product="putative MSF transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03501"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87132"
FT                   /db_xref="GOA:D2TK02"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK02"
FT                   /protein_id="CBG87132.1"
FT                   /translation="MSTQVITSDYAVASGTASTPDALLARLERLPITRRLKAIRVIVGL
FT                   STFFDAYTIIAIAFALPQLTQEWGLTPTFVGLIIAASYVGQLCGALFFGSLAEKIGRIG
FT                   VLRITIIMFVLMDAACLFAWNGWSILIIRFLQGVGIGAEVPVASAYINEFVGAKKRGRF
FT                   FLLYEVIFPIGMMFAGLVGYFLVPIYGWKVMFLIGLVPSALTVPLRWLMPESPRWLTAK
FT                   GRLKEAENVVSTLESEVIRRGMTLPEPEIKAPTVHKAAPEGAKALFSGIYKSRTFMLWG
FT                   LWLTVYSVNNGMITWFPTLYKTWFNLSLDTSLAYGWITSSCGVVASVICALMIDRVGRK
FT                   RWYTWAFLLAIVPLIALSVLGAKSAVEILILGSLTYAILQTIAFSLYLYAAELYPTRLR
FT                   AIGTAYSSAWLRAGSSIGPLMVGFIVSGFGIRFVFITFTVIALIGGLITWLFAIETKGK
FT                   SLEELSP"
     MSTQVITSDY AVASGTASTP DALLARLERL PITRRLKAIR VIVGLSTFFD AYTIIAIAFA        60
     LPQLTQEWGL TPTFVGLIIA ASYVGQLCGA LFFGSLAEKI GRIGVLRITI IMFVLMDAAC       120
     LFAWNGWSIL IIRFLQGVGI GAEVPVASAY INEFVGAKKR GRFFLLYEVI FPIGMMFAGL       180
     VGYFLVPIYG WKVMFLIGLV PSALTVPLRW LMPESPRWLT AKGRLKEAEN VVSTLESEVI       240
     RRGMTLPEPE IKAPTVHKAA PEGAKALFSG IYKSRTFMLW GLWLTVYSVN NGMITWFPTL       300
     YKTWFNLSLD TSLAYGWITS SCGVVASVIC ALMIDRVGRK RWYTWAFLLA IVPLIALSVL       360
     GAKSAVEILI LGSLTYAILQ TIAFSLYLYA AELYPTRLRA IGTAYSSAWL RAGSSIGPLM       420
     VGFIVSGFGI RFVFITFTVI ALIGGLITWL FAIETKGKSL EELSP                       465
//

If you have problems or comments...

PBIL Back to PBIL home page