(data stored in ACNUC8465 zone)

EMBL: FN543502.PE356

FN543502.PE356       Location/Qualifiers
FT   CDS             382975..383904
FT                   /transl_table=11
FT                   /locus_tag="ROD_03521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87134"
FT                   /db_xref="GOA:D2TK04"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK04"
FT                   /protein_id="CBG87134.1"
FT                   /translation="MINIDLRGLTPAPVTPFTRDGRVDYDAIQRLGNWLGSIDGVKGLV
FT                   VLGHAGEGTFLTQEEQANVIRAFVKSVDDKLPIIAGITGEGTEVAALEAKRAVAAGASA
FT                   GLLYPSHGWLRFGYQDGAPQDRYRVVYEESGLPLILFQYPDVTKATYNLKTLLDISAQP
FT                   GVFAMKNGVRNMRRWDTEIPVIRCERPDLQILSCHDEYLLHTAFDVDGFLVGYGNIAPE
FT                   PLIEMIKAGKAGDYVKARQLHDRLLPVTKSVYHRGSHMEGTVALKHALVARGILEHATV
FT                   RSPLLPLEKGAEKEIHDAMRAAELGRVR"
     MINIDLRGLT PAPVTPFTRD GRVDYDAIQR LGNWLGSIDG VKGLVVLGHA GEGTFLTQEE        60
     QANVIRAFVK SVDDKLPIIA GITGEGTEVA ALEAKRAVAA GASAGLLYPS HGWLRFGYQD       120
     GAPQDRYRVV YEESGLPLIL FQYPDVTKAT YNLKTLLDIS AQPGVFAMKN GVRNMRRWDT       180
     EIPVIRCERP DLQILSCHDE YLLHTAFDVD GFLVGYGNIA PEPLIEMIKA GKAGDYVKAR       240
     QLHDRLLPVT KSVYHRGSHM EGTVALKHAL VARGILEHAT VRSPLLPLEK GAEKEIHDAM       300
     RAAELGRVR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page