(data stored in ACNUC8465 zone)

EMBL: FN543502.PE388

FN543502.PE388       Location/Qualifiers
FT   CDS             complement(420474..421409)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03841"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87166"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK36"
FT                   /protein_id="CBG87166.1"
FT                   /translation="MQQSLTGLTAEAVRDPQVAFLTDDGRDVLRFAREALAAGMEAALV
FT                   TLVEITGGAARPLGAQMAVREDGHYCGFVSGGCVESAVAFEALEVIRSGQDRTVRYGAG
FT                   SPWFDIVLPCGGGITLRIHKLRSAQPLLAVLKALEQRQSASLRYNSATQTLHMQPGYAR
FT                   ARWRDDEFVQGFRPCVRVMIFGRSVEAQSTALLAEAAGYDVQLCADASLPQMPDADTAV
FT                   ILLWHDLDRELPVLQAALAAKPFYIGALGSCRTHRKRVAKLVEQGWREADIARIKAPVG
FT                   IFPQARDARSLALSVLADVAAARLQGEESG"
     MQQSLTGLTA EAVRDPQVAF LTDDGRDVLR FAREALAAGM EAALVTLVEI TGGAARPLGA        60
     QMAVREDGHY CGFVSGGCVE SAVAFEALEV IRSGQDRTVR YGAGSPWFDI VLPCGGGITL       120
     RIHKLRSAQP LLAVLKALEQ RQSASLRYNS ATQTLHMQPG YARARWRDDE FVQGFRPCVR       180
     VMIFGRSVEA QSTALLAEAA GYDVQLCADA SLPQMPDADT AVILLWHDLD RELPVLQAAL       240
     AAKPFYIGAL GSCRTHRKRV AKLVEQGWRE ADIARIKAPV GIFPQARDAR SLALSVLADV       300
     AAARLQGEES G                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page