(data stored in ACNUC8465 zone)

EMBL: FN543502.PE389

FN543502.PE389       Location/Qualifiers
FT   CDS             complement(421419..423617)
FT                   /transl_table=11
FT                   /locus_tag="ROD_03851"
FT                   /product="putative xanthine
FT                   dehydrogenase,molybdenum-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87167"
FT                   /db_xref="GOA:D2TK37"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK37"
FT                   /protein_id="CBG87167.1"
FT                   /translation="MKFEEPAGTNPIDQMKVVGRPHDRIDGPRKTTGTAPYAYEWHDIA
FT                   PDATYGYIVDSAIAKGRIVSMNIQPALNAPGVLAVVTAENAGPLGKGERNAATLLGGPE
FT                   IEHYQQAVALVVAETFEQARAAASLVQVEYQREPGAYDLAQEKPSVTTPPEDQPDQNVG
FT                   DFASAWAAAEVKLDAIYTTPDQSHMAMEPHASMAIQEGDKLTLWTSNQMINWARTDLAA
FT                   TLKMPEENIRVISPYIGGGFGGKLFLRSDALLSALGARAVNRPVKVMVPRPVIPNNTTH
FT                   RPATIQHIRIGTDREGRITAIAHDSWSGNLPGGSPETAVNQSKFLYAGANRHTGLRLAH
FT                   LDLPEGNSMRAPGETPGLMALEIAIDEMAIRAGVDPVEFRILNDTQVDPANPERPFSRR
FT                   QLIECLRTGAERFGWQHRHATPGQVRDGNWLIGMGMAAGYRDNVVVPSGARVQFHANGT
FT                   LTVETDMTDIGTGSYTIIAQTAAEMLGLPLEKVEVRLGDSAFPVSAGSGGQWGANTSTA
FT                   GVYAACVKLRETIAATLGFDPATATFAEEKIHADGRSVALREAAANGTLSAEDTIEFGD
FT                   LAKKYQQSTFAGHFVEVGVDVATGEIRVRRMLAVCAAGRILNPKTARSQVIGAMTMGIG
FT                   AALMEELAVDTRQGYFVNHDLAAYEVPVHADIPQQEVIFLEDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGVRVRDYPIRLDKLLSALPDAV"
     MKFEEPAGTN PIDQMKVVGR PHDRIDGPRK TTGTAPYAYE WHDIAPDATY GYIVDSAIAK        60
     GRIVSMNIQP ALNAPGVLAV VTAENAGPLG KGERNAATLL GGPEIEHYQQ AVALVVAETF       120
     EQARAAASLV QVEYQREPGA YDLAQEKPSV TTPPEDQPDQ NVGDFASAWA AAEVKLDAIY       180
     TTPDQSHMAM EPHASMAIQE GDKLTLWTSN QMINWARTDL AATLKMPEEN IRVISPYIGG       240
     GFGGKLFLRS DALLSALGAR AVNRPVKVMV PRPVIPNNTT HRPATIQHIR IGTDREGRIT       300
     AIAHDSWSGN LPGGSPETAV NQSKFLYAGA NRHTGLRLAH LDLPEGNSMR APGETPGLMA       360
     LEIAIDEMAI RAGVDPVEFR ILNDTQVDPA NPERPFSRRQ LIECLRTGAE RFGWQHRHAT       420
     PGQVRDGNWL IGMGMAAGYR DNVVVPSGAR VQFHANGTLT VETDMTDIGT GSYTIIAQTA       480
     AEMLGLPLEK VEVRLGDSAF PVSAGSGGQW GANTSTAGVY AACVKLRETI AATLGFDPAT       540
     ATFAEEKIHA DGRSVALREA AANGTLSAED TIEFGDLAKK YQQSTFAGHF VEVGVDVATG       600
     EIRVRRMLAV CAAGRILNPK TARSQVIGAM TMGIGAALME ELAVDTRQGY FVNHDLAAYE       660
     VPVHADIPQQ EVIFLEDTDP ISSPMKAKGV GELGLCGVSA AIANAVYNAT GVRVRDYPIR       720
     LDKLLSALPD AV                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page