(data stored in ACNUC8465 zone)

EMBL: FN543502.PE392

FN543502.PE392       Location/Qualifiers
FT   CDS             425495..427048
FT                   /transl_table=11
FT                   /locus_tag="ROD_03881"
FT                   /product="putative peptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03881"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87170"
FT                   /db_xref="GOA:D2TK40"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK40"
FT                   /protein_id="CBG87170.1"
FT                   /translation="MHSSVNKNESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILFM
FT                   AATVYDGGMGLARENASAIVGIFAGTMYLAALPGGWLADNWLGQQRAVWYGSILIALGH
FT                   LSIALSAWMGDNLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDARRDGGFSLFYMGIN
FT                   IGSFIAPLISGWLIKSHGWHWGFGIGGIGMLVALIIFRLFAVPAMKRYDSEVGLDSTWN
FT                   SPVAKKNGVGAWLLALAVGITILVTLIAQGVIVINPVAVASMLVYVIAASVALYFIYLF
FT                   AFAGLTRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMVGDFEIPAVWF
FT                   QSINALFIILLAPVFSWAWPALARKNVRPGSISKFVIGILCAAAGFGLMMLAAQNVLSN
FT                   GGAGVSPFWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCASALGNLAA
FT                   GLIGGHVKADQLDMLPDLFARCSVALLICAAVLMVLIVPVRRMLENAQQKTEQKPITHA
FT                   "
     MHSSVNKNES RTFFGHPYPL GSLFFTEMWE RFSFYGIRPL LILFMAATVY DGGMGLAREN        60
     ASAIVGIFAG TMYLAALPGG WLADNWLGQQ RAVWYGSILI ALGHLSIALS AWMGDNLFFI       120
     GLMFIVLGSG LFKTCISVMV GTLYKKGDAR RDGGFSLFYM GINIGSFIAP LISGWLIKSH       180
     GWHWGFGIGG IGMLVALIIF RLFAVPAMKR YDSEVGLDST WNSPVAKKNG VGAWLLALAV       240
     GITILVTLIA QGVIVINPVA VASMLVYVIA ASVALYFIYL FAFAGLTRKE RARLLVCFIL       300
     LVSAAFFWSA FEQKPTSFNL FANDYTNRMV GDFEIPAVWF QSINALFIIL LAPVFSWAWP       360
     ALARKNVRPG SISKFVIGIL CAAAGFGLMM LAAQNVLSNG GAGVSPFWLV GSILMLTLGE       420
     LCLSPIGLAT MTLLAPERMR GQMMGLWFCA SALGNLAAGL IGGHVKADQL DMLPDLFARC       480
     SVALLICAAV LMVLIVPVRR MLENAQQKTE QKPITHA                                517
//

If you have problems or comments...

PBIL Back to PBIL home page