(data stored in ACNUC8465 zone)

EMBL: FN543502.PE394

FN543502.PE394       Location/Qualifiers
FT   CDS             431335..432735
FT                   /transl_table=11
FT                   /locus_tag="ROD_03901"
FT                   /product="putative terminal oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03901"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87172"
FT                   /db_xref="GOA:D2TK42"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D2TK42"
FT                   /protein_id="CBG87172.1"
FT                   /translation="MDIDAFLLARIQFAFTVSFHIIFPAITIGLASYLAVLEGLWLKTN
FT                   NPVWRSLYQFWVKVFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEVVNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRKMFSMA
FT                   LWMAMLVAPVQALIGDMHGLNTLEHQPVKIAAIEGHWENRPDEPTPLTLVGWPDMEAEE
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKDERPNSTIVFWSFRLMVGMGVLMILLGL
FT                   ASLWLRYKNRLYQSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLQRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYLYMIRLIQKGPQPFEPPTSETDGRPARPISAVG
FT                   EPLDQEKR"
     MDIDAFLLAR IQFAFTVSFH IIFPAITIGL ASYLAVLEGL WLKTNNPVWR SLYQFWVKVF        60
     AVNFGMGVVS GLVMAYQFGT NWSGFSQFAG SITGPLLTYE VLTAFFLEAG FLGVMLFGWN       120
     KVGPGLHFLS TCMVALGTLM STFWILASNS WMHTPQGFEV VNGQVVPVDW FAVIFNPSFP       180
     YRLLHMSVAA FLSSAMFVGA SAAWHLLKGN DTPAIRKMFS MALWMAMLVA PVQALIGDMH       240
     GLNTLEHQPV KIAAIEGHWE NRPDEPTPLT LVGWPDMEAE ETRYALEIPA LGSLILTHSL       300
     DKQVPALKDY PKDERPNSTI VFWSFRLMVG MGVLMILLGL ASLWLRYKNR LYQSRPFMHF       360
     ALWMGPSGLI AILAGWVTTE VGRQPWVVYG LQRTRDAVSA HSTLQMSISL LAFFVVYSLV       420
     FGVGYLYMIR LIQKGPQPFE PPTSETDGRP ARPISAVGEP LDQEKR                      466
//

If you have problems or comments...

PBIL Back to PBIL home page