(data stored in ACNUC8465 zone)

EMBL: FN543502.PE420

FN543502.PE420       Location/Qualifiers
FT   CDS             468906..469574
FT                   /transl_table=11
FT                   /locus_tag="ROD_04161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04161"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87198"
FT                   /db_xref="GOA:D2TKV7"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV7"
FT                   /protein_id="CBG87198.1"
FT                   /translation="MPIKDLMGITARKASMLSLDKPLKEFALLNKCLSKYGTRFEIPRQ
FT                   KECLFSENIAHDNTIVIQEGLISLRRQEQVLVGIGQAPVILGLDNGVMKNEVQYDIFTE
FT                   GACSGYYLPSTKTVEVIEECQLWREACYWITWLNRFLELRDRQLIGNNSYEQIRSTLIT
FT                   MNEWEEALRSRIGVMNYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVKINRLPYEY
FT                   "
     MPIKDLMGIT ARKASMLSLD KPLKEFALLN KCLSKYGTRF EIPRQKECLF SENIAHDNTI        60
     VIQEGLISLR RQEQVLVGIG QAPVILGLDN GVMKNEVQYD IFTEGACSGY YLPSTKTVEV       120
     IEECQLWREA CYWITWLNRF LELRDRQLIG NNSYEQIRST LITMNEWEEA LRSRIGVMNY       180
     IHQRTRISRS VVAEVLAALR KGGYIEMNKG KLVKINRLPY EY                          222
//

If you have problems or comments...

PBIL Back to PBIL home page