(data stored in ACNUC8465 zone)

EMBL: FN543502.PE436

FN543502.PE436       Location/Qualifiers
FT   CDS             483803..483994
FT                   /transl_table=11
FT                   /locus_tag="ROD_04331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04331"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87214"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX3"
FT                   /protein_id="CBG87214.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGAPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKKRYEDPEKS"
     MPTRPPYPRE AYIVTIEKGA PGQTVTWYQL RADHPKPDSL ISEHPTAEEA MDAKKRYEDP        60
     EKS                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page