(data stored in ACNUC8465 zone)

EMBL: FN543502.PE459

FN543502.PE459       Location/Qualifiers
FT   CDS             513241..513606
FT                   /transl_table=11
FT                   /locus_tag="ROD_04581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04581"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87237"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ6"
FT                   /protein_id="CBG87237.1"
FT                   /translation="MKSIINWFEIPVADMARAIAFYEPVLGLSLRREKMDGADLAVFPY
FT                   EDPATGGALAKIDGLLPSAQGAVIYLHTDDLAAALERVVSAGGECVFGPLDLGKEIGTV
FT                   ALFIDSEGNRVGLHQPA"
     MKSIINWFEI PVADMARAIA FYEPVLGLSL RREKMDGADL AVFPYEDPAT GGALAKIDGL        60
     LPSAQGAVIY LHTDDLAAAL ERVVSAGGEC VFGPLDLGKE IGTVALFIDS EGNRVGLHQP       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page