(data stored in ACNUC8465 zone)

EMBL: FN543502.PE476

FN543502.PE476       Location/Qualifiers
FT   CDS             527881..528390
FT                   /transl_table=11
FT                   /locus_tag="ROD_04751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04751"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87254"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL13"
FT                   /protein_id="CBG87254.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEASI
FT                   ELNDANKTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPEEFVHSGKTWYVEAKL
FT                   KQGIESAVQKKIVKLIKDSKLKVQAQIQGDEIRVTGKSRDDLQSVMALVRGGDLGQPFQ
FT                   FKNFRD"
     MKGEEKMPSF DIVSEVDLQE ARNGVDNAVR EVESRFDFRG VEASIELNDA NKTIKVLSES        60
     DFQVNQLLDI LRAKLLKRGI EGASLDVPEE FVHSGKTWYV EAKLKQGIES AVQKKIVKLI       120
     KDSKLKVQAQ IQGDEIRVTG KSRDDLQSVM ALVRGGDLGQ PFQFKNFRD                   169
//

If you have problems or comments...

PBIL Back to PBIL home page