(data stored in ACNUC8465 zone)

EMBL: FN543502.PE480

FN543502.PE480       Location/Qualifiers
FT   CDS             complement(532272..533966)
FT                   /transl_table=11
FT                   /locus_tag="ROD_04791"
FT                   /product="putative flavoprotein subunit of a reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04791"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87258"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL17"
FT                   /protein_id="CBG87258.1"
FT                   /translation="MSRHVEVDLLVIGSGAAGLSAAVSAALHGGRVLVAEKEPVIGGTS
FT                   AWSGGWLWIPQNPLAREEGIVEEDDAPLTYLRAEMEGRPADARLLAFLRHGPEMVEFFR
FT                   RRTAVQFLSGSKMPDFHNSEGFATGGRSVTAQPYDARELGDWVHRLRPPLETISLAGMG
FT                   IAGGQDMAHFFNATRSPRSALYAARRLATHYWQRLRYGRGLHLVNGNALVARLLRSALD
FT                   AGVSFQLNAPVYRLLQGEHGVTGALLGSDEGEIRVNARAVVLACGGFPHDKQRLAEQVT
FT                   HAREGYGHFSAAPPGNQGDGIRLGESVGGQFDASLKHPMAWAPVSRVSLSSGLQLAFPH
FT                   LVERAKPGFIAVLPDGKRFVNEADSYHDFIAALLDATPPGEKPQAWLIGDHRALRRYGM
FT                   GHARPSPFPLSAWLRTGYLYSGATLEELAEKCAIDGTALCATVKRFNDFARQGRDDDFR
FT                   RGASAYNRAQGDASHRPSPTLGTLAKAPYYAVRILPGSLGSFSGLKTDEQARVLDAGQR
FT                   PVPGLFAVGNDMSSVMQGFYPSGGITLGPAMTFGYLVGKNLFAHITT"
     MSRHVEVDLL VIGSGAAGLS AAVSAALHGG RVLVAEKEPV IGGTSAWSGG WLWIPQNPLA        60
     REEGIVEEDD APLTYLRAEM EGRPADARLL AFLRHGPEMV EFFRRRTAVQ FLSGSKMPDF       120
     HNSEGFATGG RSVTAQPYDA RELGDWVHRL RPPLETISLA GMGIAGGQDM AHFFNATRSP       180
     RSALYAARRL ATHYWQRLRY GRGLHLVNGN ALVARLLRSA LDAGVSFQLN APVYRLLQGE       240
     HGVTGALLGS DEGEIRVNAR AVVLACGGFP HDKQRLAEQV THAREGYGHF SAAPPGNQGD       300
     GIRLGESVGG QFDASLKHPM AWAPVSRVSL SSGLQLAFPH LVERAKPGFI AVLPDGKRFV       360
     NEADSYHDFI AALLDATPPG EKPQAWLIGD HRALRRYGMG HARPSPFPLS AWLRTGYLYS       420
     GATLEELAEK CAIDGTALCA TVKRFNDFAR QGRDDDFRRG ASAYNRAQGD ASHRPSPTLG       480
     TLAKAPYYAV RILPGSLGSF SGLKTDEQAR VLDAGQRPVP GLFAVGNDMS SVMQGFYPSG       540
     GITLGPAMTF GYLVGKNLFA HITT                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page