(data stored in ACNUC8465 zone)

EMBL: FN543502.PE78

FN543502.PE78        Location/Qualifiers
FT   CDS             complement(91223..92878)
FT                   /transl_table=11
FT                   /locus_tag="ROD_00761"
FT                   /product="putative substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00761"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86856"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH5"
FT                   /protein_id="CBG86856.1"
FT                   /translation="MSSGRLQQQFIRLWQCCDGKTQDTTLNELAELLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKTAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPLQNLLPGTALRRSETHIARQIFSALTRVNEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGIHFHHGRELEMEDVIASLRRINDLPLYSHIAHIVS
FT                   PTPWTLDIHLSQPDRWLPLLLAQVPAMILPREWETLNNFASQPIGTGPYAVMRNTRNQL
FT                   KIHAFEDFFGYRALIDEVNVWVLPDICDERTGALTLKGPTDDEKAIESRLEEGCYYLLF
FT                   DARTHRGANQAVREWVSRILSPSNLLYYANEHYQRHWFPAYGLLPRWHHARPGHGEKPA
FT                   GLETLTLTFYRDHIEHQIIARIMSKLLAEHQVKLDIQEIDYDRWHAGDVESDIWLNSAN
FT                   FTLPLDFSLFAYLCEVPLLQHCIPLDWQADAARWRTGEMNLAAWCQQLLASKAIVPLIH
FT                   HWLIIEGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
     MSSGRLQQQF IRLWQCCDGK TQDTTLNELA ELLNCSRRHM RTLLNTMQAR GWLTWEAEVG        60
     RGKRSRLTFL YTGLALQQQR AEDLLEQDRI DQLVQLVGDK TAVRQMLISH LGRSFRQGRH       120
     ILRVLYYRPL QNLLPGTALR RSETHIARQI FSALTRVNEE NGELEADIAH HWQQISPLHW       180
     RFFLRPGIHF HHGRELEMED VIASLRRIND LPLYSHIAHI VSPTPWTLDI HLSQPDRWLP       240
     LLLAQVPAMI LPREWETLNN FASQPIGTGP YAVMRNTRNQ LKIHAFEDFF GYRALIDEVN       300
     VWVLPDICDE RTGALTLKGP TDDEKAIESR LEEGCYYLLF DARTHRGANQ AVREWVSRIL       360
     SPSNLLYYAN EHYQRHWFPA YGLLPRWHHA RPGHGEKPAG LETLTLTFYR DHIEHQIIAR       420
     IMSKLLAEHQ VKLDIQEIDY DRWHAGDVES DIWLNSANFT LPLDFSLFAY LCEVPLLQHC       480
     IPLDWQADAA RWRTGEMNLA AWCQQLLASK AIVPLIHHWL IIEGQRSMRG LRMNTLGWFD       540
     FKSAWFAPPD P                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page