(data stored in ACNUC8465 zone)

EMBL: FN543502.RIBD

FN543502.RIBD        Location/Qualifiers
FT   CDS             516657..517760
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ROD_04631"
FT                   /product="riboflavin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87242"
FT                   /db_xref="GOA:D2TL01"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL01"
FT                   /protein_id="CBG87242.1"
FT                   /translation="MQDELYMARALKLAARGRFTTHPNPNVGCVIVKDGEIVGEGYHYR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGMARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIEVSHGLMMSEAEALNKGFLKRMRTGFPYVQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSETVLADDPQLTVRWSELGEATQAAYPQE
FT                   NLRQPVRIVIDSRNRVTPEHRIVSQPGETWFARTKEDDRVWPESVRTIQVPEHNGHLDL
FT                   VLLLMLLGKQQINSLWVEAGPTLAGALLQAGVVDELIMYVAPKLLGSDARGLCVLPGLE
FT                   KLADAPQFQFKEIRYTGPDVCLHLIPA"
     MQDELYMARA LKLAARGRFT THPNPNVGCV IVKDGEIVGE GYHYRAGEPH AEVHALRMAG        60
     EKAKGATAYV TLEPCSHHGR TPPCCDALIA AGMARVVAAM QDPNPQVAGR GLYRLQQAGI       120
     EVSHGLMMSE AEALNKGFLK RMRTGFPYVQ LKLGASLDGR TAMASGESQW ITSPQARRDV       180
     QRLRAQSHAI LTSSETVLAD DPQLTVRWSE LGEATQAAYP QENLRQPVRI VIDSRNRVTP       240
     EHRIVSQPGE TWFARTKEDD RVWPESVRTI QVPEHNGHLD LVLLLMLLGK QQINSLWVEA       300
     GPTLAGALLQ AGVVDELIMY VAPKLLGSDA RGLCVLPGLE KLADAPQFQF KEIRYTGPDV       360
     CLHLIPA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page