(data stored in ACNUC8465 zone)

EMBL: FN543502.RLUA

FN543502.RLUA        Location/Qualifiers
FT   CDS             complement(74424..75083)
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ROD_00631"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86844"
FT                   /db_xref="GOA:D2TGG2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGG2"
FT                   /protein_id="CBG86844.1"
FT                   /translation="MGMENYNPPREPWLVVLYQDEHIMVVNKPSGLLSVPGRLEEHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   VPAEGVVDLPLICDWPNRPKQKVCYETGKAAQTGYEVVEYAADNTARVVLKPTTGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
     MGMENYNPPR EPWLVVLYQD EHIMVVNKPS GLLSVPGRLE EHKDSIMTRI QRDYPQAESV        60
     HRLDMATSGV IVVALTKAAE RELKRQFRER EPKKQYVARV WGHPVPAEGV VDLPLICDWP       120
     NRPKQKVCYE TGKAAQTGYE VVEYAADNTA RVVLKPTTGR SHQLRVHMLA LGHPILGDRF       180
     YASPEALAMA PRLLLHAEML TITHPAYGNS MTFKAPADF                              219
//

If you have problems or comments...

PBIL Back to PBIL home page