(data stored in ACNUC8465 zone)

EMBL: FN543502.SBMA

FN543502.SBMA        Location/Qualifiers
FT   CDS             471074..472294
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ROD_04181"
FT                   /product="putative microcin B17 uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04181"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87200"
FT                   /db_xref="GOA:D2TKV9"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV9"
FT                   /protein_id="CBG87200.1"
FT                   /translation="MFKSFFPKPGPFFLSALIWAVIAIIFWQAGGGARLAHLSGASGDA
FT                   PISAARFWSPGYLIFYAYYALCVGAFALFWFTYSPHRWQYWSITGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQQALTSPHKVTMAQFYNGLGIFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMAHWQHLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLVAFLPV
FT                   LITLSAHVPELPVVGHVPYSLVMAAIVWSLIGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDASRAAPPTVRELFSAVRQNYFRLYFHYMYFNIARILYLQADNVFGLFLLFP
FT                   SIVAGTLTLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHTLDDKEIQ
FT                   VVTHTLG"
     MFKSFFPKPG PFFLSALIWA VIAIIFWQAG GGARLAHLSG ASGDAPISAA RFWSPGYLIF        60
     YAYYALCVGA FALFWFTYSP HRWQYWSITG TALIIFVTWF LVEVGVAVNA WYAPFYDLIQ       120
     QALTSPHKVT MAQFYNGLGI FLGIALIAVV ISVLNNFFVS HYVFRWRTAM NEYYMAHWQH       180
     LRHIEGAAQR VQEDTMRFAS TLENMGVSFI NAIMTLVAFL PVLITLSAHV PELPVVGHVP       240
     YSLVMAAIVW SLIGTGLLAV VGIKLPGLEF KNQRVEAAYR KELVYGEDDA SRAAPPTVRE       300
     LFSAVRQNYF RLYFHYMYFN IARILYLQAD NVFGLFLLFP SIVAGTLTLG LMTQITNVFG       360
     QVRGAFQYLI NSWTTLVELM SIYKRLRSFE HTLDDKEIQV VTHTLG                      406
//

If you have problems or comments...

PBIL Back to PBIL home page